From 405631f527e6420c6523dfeb516a436513af2a03 Mon Sep 17 00:00:00 2001 From: alain viari Date: Fri, 13 Nov 2015 22:37:22 +0100 Subject: [PATCH] cds go_test bug fixed Former-commit-id: f73133dca83d02a0c223e98a3ac82fdb0d03c5ae Former-commit-id: 3db7c0037f7c109f4479490480d4323a55206c6a --- detectors/cds/bin/do_exonerate.sh | 59 +++++++++++++------ detectors/cds/bin/go_cds.sh | 26 ++++---- detectors/cds/lib/toEmbl.awk | 14 +++++ detectors/cds/params/default | 10 ++-- detectors/cds/test/go_test.sh | 4 +- .../cds/test/test.db/{ => core}/Annot.lst | 0 .../cds/test/test.db/{ => core}/atpf.fst | 0 .../cds/test/test.db/{ => core}/ccsa.fst | 0 .../cds/test/test.db/{ => core}/ndha.fst | 0 .../cds/test/test.db/{ => core}/ndhb.fst | 0 .../cds/test/test.db/{ => core}/ndhd.fst | 0 .../cds/test/test.db/{ => core}/ndhe.fst | 0 .../cds/test/test.db/{ => core}/ndhf.fst | 0 .../cds/test/test.db/{ => core}/ndhg.fst | 0 .../cds/test/test.db/{ => core}/ndhh.fst | 0 .../cds/test/test.db/{ => core}/ndhi.fst | 0 .../cds/test/test.db/{ => core}/psac.fst | 0 .../cds/test/test.db/{ => core}/rpl2.fst | 0 .../cds/test/test.db/{ => core}/rpl23.fst | 0 .../cds/test/test.db/{ => core}/rpl32.fst | 0 .../cds/test/test.db/{ => core}/rps15.fst | 0 .../cds/test/test.db/{ => core}/rps7.fst | 0 .../cds/test/test.db/{ => core}/ycf1.fst | 0 .../cds/test/test.db/{ => core}/ycf2.fst | 0 .../cds/test/test.db/models/blosum62.mat | 29 +++++++++ .../cds/test/test.db/models/splice.none.frq | 6 ++ .../test/test.db/models/splice3.default.frq | 13 ++++ .../cds/test/test.db/models/splice3.ndha.frq | 13 ++++ .../cds/test/test.db/models/splice3.psba.frq | 13 ++++ .../test/test.db/models/splice5.default.frq | 13 ++++ .../cds/test/test.db/models/splice5.ndha.frq | 13 ++++ .../cds/test/test.db/models/splice5.psba.frq | 13 ++++ .../cds/test/test.db/models/start.default.frq | 8 +++ .../cds/test/test.db/models/start.ndhd.frq | 7 +++ .../cds/test/test.db/models/start.rps19.frq | 3 + .../cds/test/test.db/models/stop.default.frq | 4 ++ detectors/cds/test/test.ref | 18 ++++++ scripts/csh_init.sh | 2 +- 38 files changed, 231 insertions(+), 37 deletions(-) rename detectors/cds/test/test.db/{ => core}/Annot.lst (100%) rename detectors/cds/test/test.db/{ => core}/atpf.fst (100%) rename detectors/cds/test/test.db/{ => core}/ccsa.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndha.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhb.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhd.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhe.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhf.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhg.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhh.fst (100%) rename detectors/cds/test/test.db/{ => core}/ndhi.fst (100%) rename detectors/cds/test/test.db/{ => core}/psac.fst (100%) rename detectors/cds/test/test.db/{ => core}/rpl2.fst (100%) rename detectors/cds/test/test.db/{ => core}/rpl23.fst (100%) rename detectors/cds/test/test.db/{ => core}/rpl32.fst (100%) rename detectors/cds/test/test.db/{ => core}/rps15.fst (100%) rename detectors/cds/test/test.db/{ => core}/rps7.fst (100%) rename detectors/cds/test/test.db/{ => core}/ycf1.fst (100%) rename detectors/cds/test/test.db/{ => core}/ycf2.fst (100%) create mode 100644 detectors/cds/test/test.db/models/blosum62.mat create mode 100644 detectors/cds/test/test.db/models/splice.none.frq create mode 100644 detectors/cds/test/test.db/models/splice3.default.frq create mode 100644 detectors/cds/test/test.db/models/splice3.ndha.frq create mode 100644 detectors/cds/test/test.db/models/splice3.psba.frq create mode 100644 detectors/cds/test/test.db/models/splice5.default.frq create mode 100644 detectors/cds/test/test.db/models/splice5.ndha.frq create mode 100644 detectors/cds/test/test.db/models/splice5.psba.frq create mode 100644 detectors/cds/test/test.db/models/start.default.frq create mode 100644 detectors/cds/test/test.db/models/start.ndhd.frq create mode 100644 detectors/cds/test/test.db/models/start.rps19.frq create mode 100644 detectors/cds/test/test.db/models/stop.default.frq diff --git a/detectors/cds/bin/do_exonerate.sh b/detectors/cds/bin/do_exonerate.sh index 5fbe664..4985767 100755 --- a/detectors/cds/bin/do_exonerate.sh +++ b/detectors/cds/bin/do_exonerate.sh @@ -15,47 +15,66 @@ # #======================================================================================== # -# usage: do_exonerate.sh dna.fasta prot.fasta [outdir] +# usage: do_exonerate.sh dna.fasta prot.fasta [model_dir [out_dir]] # unsetenv ORG_SOURCED setenv ORG_HOME `dirname $0`/../../.. source $ORG_HOME/scripts/csh_init.sh -set PARAMS_DIR = $LIB_DIR/../params -set MODELS_DIR = $LIB_DIR/../models - alias Override 'if (-e \!:2) set \!:1 = \!:2' NeedArg 2 -set GenoFile = $Argv[1] +set GenoFile = $Argv[1]; Shift set GenoName = `basename $GenoFile:r` -set ProtFile = $Argv[2] +set ProtFile = $Argv[1]; Shift set ProtDir = `dirname $ProtFile` set ProtName = `basename $ProtFile:r` +set ProtType = `basename $ProtDir` NeedFile $GenoFile NeedFile $ProtFile NeedFile $ProtDir/Annot.lst +set ModelsDir = $PROG_DIR/../models +if ($#Argv > 0) then + set ModelsDir = $Argv[1]; Shift + Notify " exonerate models : $ModelsDir" +else + Warning " using default exonerate models : $ModelsDir" +endif + +NeedFile $ModelsDir/start.default.frq +NeedFile $ModelsDir/stop.default.frq +NeedFile $ModelsDir/splice3.default.frq +NeedFile $ModelsDir/splice5.default.frq + set OutDir = . -if ($#Argv >= 3) set OutDir = $3 +if ($#Argv > 0) then + set OutDir = $Argv[1]; Shift +endif + if (! -d $OutDir) mkdir $OutDir +set ParamsDir = $PROG_DIR/../params + +NeedFile $ParamsDir/default + # # general parameters # -source $PARAMS_DIR/default +source $ParamsDir/default # # family specific parameters # -if (-e $PARAMS_DIR/$ProtName) then - source $PARAMS_DIR/$ProtName +if (-e $ParamsDir/$ProtName) then + Notify " override parameters with $ParamsDir/$ProtName" + source $ParamsDir/$ProtName endif # @@ -63,23 +82,23 @@ endif # if ($?STARTMODEL == 0) then - set STARTMODEL = $MODELS_DIR/start.default.frq - Override STARTMODEL $MODELS_DIR/start.$ProtName.frq + set STARTMODEL = $ModelsDir/start.default.frq + Override STARTMODEL $ModelsDir/start.$ProtName.frq endif if ($?STOPMODEL == 0) then - set STOPMODEL = $MODELS_DIR/stop.default.frq - Override STOPMODEL $MODELS_DIR/stop.$ProtName.frq + set STOPMODEL = $ModelsDir/stop.default.frq + Override STOPMODEL $ModelsDir/stop.$ProtName.frq endif if ($?SPLICE3MODEL == 0) then - set SPLICE3MODEL = $MODELS_DIR/splice3.default.frq - Override SPLICE3MODEL $MODELS_DIR/splice3.$ProtName.frq + set SPLICE3MODEL = $ModelsDir/splice3.default.frq + Override SPLICE3MODEL $ModelsDir/splice3.$ProtName.frq endif if ($?SPLICE5MODEL == 0) then - set SPLICE5MODEL = $MODELS_DIR/splice5.default.frq - Override SPLICE5MODEL $MODELS_DIR/splice5.$ProtName.frq + set SPLICE5MODEL = $ModelsDir/splice5.default.frq + Override SPLICE5MODEL $ModelsDir/splice5.$ProtName.frq endif # @@ -178,8 +197,10 @@ $AwkCmd -f $LIB_DIR/libutil.awk -f $LIB_DIR/extend.awk \ # translate # +echo "c pass pass1 $ProtType" > $base.iff + $AwkCmd -v FASTA=$GenoFile -f $LIB_DIR/libutil.awk \ - -f $LIB_DIR/translate.awk T_$$ > $base.iff + -f $LIB_DIR/translate.awk T_$$ >> $base.iff # # convert to embl diff --git a/detectors/cds/bin/go_cds.sh b/detectors/cds/bin/go_cds.sh index f38e053..487d458 100755 --- a/detectors/cds/bin/go_cds.sh +++ b/detectors/cds/bin/go_cds.sh @@ -13,7 +13,7 @@ # Results are printed to the standard output # #======================================================================================== -# usage: go_cds.sh fasta [db_core] +# usage: go_cds.sh fasta [db_root] # unsetenv ORG_SOURCED @@ -28,13 +28,16 @@ NeedFile $Fasta set Genome = `basename $Fasta:r` -set DbCore = $CDS_DATA_DIR/chlorodb/core +set DbRoot = $CDS_DATA_DIR/chlorodb if ($#Argv > 0) then - set DbCore = $Argv[1]; Shift + set DbRoot = $Argv[1]; Shift endif -NeedFile $DbCore/Annot.lst +NeedDir $DbRoot/core +NeedFile $DbRoot/core/Annot.lst + +NeedDir $DbRoot/models # # run everything into temporary place @@ -50,15 +53,16 @@ endif # pass1: run exonerate # -set fams = `ls $DbCore/*.fst` - -Notify "running pass1: exonerate of $Genome on $DbCore" - -foreach f ($fams) - $PROG_DIR/do_exonerate.sh $Fasta $f $temp +foreach dir ("core" "shell" "dust") + if (-d $DbRoot/$dir) then + set fams = `ls $DbRoot/$dir/*.fst` + Notify "running pass1:$dir exonerate of $Genome on $DbRoot" + foreach f ($fams) + $PROG_DIR/do_exonerate.sh $Fasta $f $DbRoot/models $temp + end + endif end - # # pass2: transsplicing # diff --git a/detectors/cds/lib/toEmbl.awk b/detectors/cds/lib/toEmbl.awk index e6df42d..1ebfa7c 100644 --- a/detectors/cds/lib/toEmbl.awk +++ b/detectors/cds/lib/toEmbl.awk @@ -67,10 +67,20 @@ function QQualifier(qual, val) { SQualifier(qual, "\"" val "\"") } +function Unk(s) { + return (s =="" ? "none" : s) +} + # # rules # +/^c pass/ { + PassType = $3 + PassInfo = $NF + next +} + /^c annot/ { GeneName = $4 Product = $NF @@ -113,6 +123,9 @@ function QQualifier(qual, val) { /^c end_entry/ { + GeneName = Unk(GeneName) + PassType = Unk(PassType) + gname = (Ngene == 1 ? GeneName : GeneName "_" ++Igene) locus = "" @@ -127,6 +140,7 @@ function QQualifier(qual, val) { QQualifier("locus_tag", locus) QQualifier("product", Product) QQualifier("inference", "similar to DNA sequence:" Simil) + QQualifier("inference", "detect pass:" PassType ":" PassInfo) QQualifier("translation", Translat) if (Nexon > 1) { diff --git a/detectors/cds/params/default b/detectors/cds/params/default index 1797145..0e7ac2f 100644 --- a/detectors/cds/params/default +++ b/detectors/cds/params/default @@ -2,9 +2,11 @@ # CDS Searching parameters # +Notify " using default exonerate parameters" + # # general parameters -# (may be overriden by enviroment variables) +# may be overriden by enviroment variables (AssignUndef) # AssignUndef TMP_CLEANUP 1 @@ -30,11 +32,11 @@ AssignUndef PASS1_BESTN 10 AssignUndef PASS1_FRAMESHIFT -100 # pass1: exonerate use Blosum62 with larger penalty for Stops -AssignUndef PASS1_SUBMAT $MODELS_DIR/blosum62.mat +AssignUndef PASS1_SUBMAT $ModelsDir/blosum62.mat # comment next lines to use default or specific splice model -# AssignUndef SPLICE3MODEL $MODELS_DIR/splice.none.frq -# AssignUndef SPLICE5MODEL $MODELS_DIR/splice.none.frq +# AssignUndef SPLICE3MODEL $ModelsDir/splice.none.frq +# AssignUndef SPLICE5MODEL $ModelsDir/splice.none.frq # # pass1: cluster selection parameters diff --git a/detectors/cds/test/go_test.sh b/detectors/cds/test/go_test.sh index 9e62ae4..fad2596 100755 --- a/detectors/cds/test/go_test.sh +++ b/detectors/cds/test/go_test.sh @@ -1,6 +1,6 @@ #!/bin/csh -f -setenv Verbose 1 +setenv Verbose 0 setenv ORG_HOME `dirname $0`/../../.. source $ORG_HOME/scripts/csh_init.sh @@ -20,7 +20,7 @@ set stat = $status if ($stat == 0) then echo "+ $VTC[3]CDS test Ok$VTC[1]" - \rm -r test.bak test.tmp test.db/*.fst.p?? + \rm -r test.bak test.tmp test.db/core/*.fst.p?? else echo "* $VTC[2]CDS test Failure$VTC[1]" endif diff --git a/detectors/cds/test/test.db/Annot.lst b/detectors/cds/test/test.db/core/Annot.lst similarity index 100% rename from detectors/cds/test/test.db/Annot.lst rename to detectors/cds/test/test.db/core/Annot.lst diff --git a/detectors/cds/test/test.db/atpf.fst b/detectors/cds/test/test.db/core/atpf.fst similarity index 100% rename from detectors/cds/test/test.db/atpf.fst rename to detectors/cds/test/test.db/core/atpf.fst diff --git a/detectors/cds/test/test.db/ccsa.fst b/detectors/cds/test/test.db/core/ccsa.fst similarity index 100% rename from detectors/cds/test/test.db/ccsa.fst rename to detectors/cds/test/test.db/core/ccsa.fst diff --git a/detectors/cds/test/test.db/ndha.fst b/detectors/cds/test/test.db/core/ndha.fst similarity index 100% rename from detectors/cds/test/test.db/ndha.fst rename to detectors/cds/test/test.db/core/ndha.fst diff --git a/detectors/cds/test/test.db/ndhb.fst b/detectors/cds/test/test.db/core/ndhb.fst similarity index 100% rename from detectors/cds/test/test.db/ndhb.fst rename to detectors/cds/test/test.db/core/ndhb.fst diff --git a/detectors/cds/test/test.db/ndhd.fst b/detectors/cds/test/test.db/core/ndhd.fst similarity index 100% rename from detectors/cds/test/test.db/ndhd.fst rename to detectors/cds/test/test.db/core/ndhd.fst diff --git a/detectors/cds/test/test.db/ndhe.fst b/detectors/cds/test/test.db/core/ndhe.fst similarity index 100% rename from detectors/cds/test/test.db/ndhe.fst rename to detectors/cds/test/test.db/core/ndhe.fst diff --git a/detectors/cds/test/test.db/ndhf.fst b/detectors/cds/test/test.db/core/ndhf.fst similarity index 100% rename from detectors/cds/test/test.db/ndhf.fst rename to detectors/cds/test/test.db/core/ndhf.fst diff --git a/detectors/cds/test/test.db/ndhg.fst b/detectors/cds/test/test.db/core/ndhg.fst similarity index 100% rename from detectors/cds/test/test.db/ndhg.fst rename to detectors/cds/test/test.db/core/ndhg.fst diff --git a/detectors/cds/test/test.db/ndhh.fst b/detectors/cds/test/test.db/core/ndhh.fst similarity index 100% rename from detectors/cds/test/test.db/ndhh.fst rename to detectors/cds/test/test.db/core/ndhh.fst diff --git a/detectors/cds/test/test.db/ndhi.fst b/detectors/cds/test/test.db/core/ndhi.fst similarity index 100% rename from detectors/cds/test/test.db/ndhi.fst rename to detectors/cds/test/test.db/core/ndhi.fst diff --git a/detectors/cds/test/test.db/psac.fst b/detectors/cds/test/test.db/core/psac.fst similarity index 100% rename from detectors/cds/test/test.db/psac.fst rename to detectors/cds/test/test.db/core/psac.fst diff --git a/detectors/cds/test/test.db/rpl2.fst b/detectors/cds/test/test.db/core/rpl2.fst similarity index 100% rename from detectors/cds/test/test.db/rpl2.fst rename to detectors/cds/test/test.db/core/rpl2.fst diff --git a/detectors/cds/test/test.db/rpl23.fst b/detectors/cds/test/test.db/core/rpl23.fst similarity index 100% rename from detectors/cds/test/test.db/rpl23.fst rename to detectors/cds/test/test.db/core/rpl23.fst diff --git a/detectors/cds/test/test.db/rpl32.fst b/detectors/cds/test/test.db/core/rpl32.fst similarity index 100% rename from detectors/cds/test/test.db/rpl32.fst rename to detectors/cds/test/test.db/core/rpl32.fst diff --git a/detectors/cds/test/test.db/rps15.fst b/detectors/cds/test/test.db/core/rps15.fst similarity index 100% rename from detectors/cds/test/test.db/rps15.fst rename to detectors/cds/test/test.db/core/rps15.fst diff --git a/detectors/cds/test/test.db/rps7.fst b/detectors/cds/test/test.db/core/rps7.fst similarity index 100% rename from detectors/cds/test/test.db/rps7.fst rename to detectors/cds/test/test.db/core/rps7.fst diff --git a/detectors/cds/test/test.db/ycf1.fst b/detectors/cds/test/test.db/core/ycf1.fst similarity index 100% rename from detectors/cds/test/test.db/ycf1.fst rename to detectors/cds/test/test.db/core/ycf1.fst diff --git a/detectors/cds/test/test.db/ycf2.fst b/detectors/cds/test/test.db/core/ycf2.fst similarity index 100% rename from detectors/cds/test/test.db/ycf2.fst rename to detectors/cds/test/test.db/core/ycf2.fst diff --git a/detectors/cds/test/test.db/models/blosum62.mat b/detectors/cds/test/test.db/models/blosum62.mat new file mode 100644 index 0000000..37f3f29 --- /dev/null +++ b/detectors/cds/test/test.db/models/blosum62.mat @@ -0,0 +1,29 @@ +# +# blosum62 substitution matrix +# with larger penalty for stops +# + A R N D C Q E G H I L K M F P S T W Y V B Z X * +A 4 -1 -2 -2 0 -1 -1 0 -2 -1 -1 -1 -1 -2 -1 1 0 -3 -2 0 -2 -1 0 -50 +R -1 5 0 -2 -3 1 0 -2 0 -3 -2 2 -1 -3 -2 -1 -1 -3 -2 -3 -1 0 -1 -50 +N -2 0 6 1 -3 0 0 0 1 -3 -3 0 -2 -3 -2 1 0 -4 -2 -3 3 0 -1 -50 +D -2 -2 1 6 -3 0 2 -1 -1 -3 -4 -1 -3 -3 -1 0 -1 -4 -3 -3 4 1 -1 -50 +C 0 -3 -3 -3 9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1 -3 -3 -2 -50 +Q -1 1 0 0 -3 5 2 -2 0 -3 -2 1 0 -3 -1 0 -1 -2 -1 -2 0 3 -1 -50 +E -1 0 0 2 -4 2 5 -2 0 -3 -3 1 -2 -3 -1 0 -1 -3 -2 -2 1 4 -1 -50 +G 0 -2 0 -1 -3 -2 -2 6 -2 -4 -4 -2 -3 -3 -2 0 -2 -2 -3 -3 -1 -2 -1 -50 +H -2 0 1 -1 -3 0 0 -2 8 -3 -3 -1 -2 -1 -2 -1 -2 -2 2 -3 0 0 -1 -50 +I -1 -3 -3 -3 -1 -3 -3 -4 -3 4 2 -3 1 0 -3 -2 -1 -3 -1 3 -3 -3 -1 -50 +L -1 -2 -3 -4 -1 -2 -3 -4 -3 2 4 -2 2 0 -3 -2 -1 -2 -1 1 -4 -3 -1 -50 +K -1 2 0 -1 -3 1 1 -2 -1 -3 -2 5 -1 -3 -1 0 -1 -3 -2 -2 0 1 -1 -50 +M -1 -1 -2 -3 -1 0 -2 -3 -2 1 2 -1 5 0 -2 -1 -1 -1 -1 1 -3 -1 -1 -50 +F -2 -3 -3 -3 -2 -3 -3 -3 -1 0 0 -3 0 6 -4 -2 -2 1 3 -1 -3 -3 -1 -50 +P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4 7 -1 -1 -4 -3 -2 -2 -1 -2 -50 +S 1 -1 1 0 -1 0 0 0 -1 -2 -2 0 -1 -2 -1 4 1 -3 -2 -2 0 0 0 -50 +T 0 -1 0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1 1 5 -2 -2 0 -1 -1 0 -50 +W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1 1 -4 -3 -2 11 2 -3 -4 -3 -2 -50 +Y -2 -2 -2 -3 -2 -1 -2 -3 2 -1 -1 -2 -1 3 -3 -2 -2 2 7 -1 -3 -2 -1 -50 +V 0 -3 -3 -3 -1 -2 -2 -3 -3 3 1 -2 1 -1 -2 -2 0 -3 -1 4 -3 -2 -1 -50 +B -2 -1 3 4 -3 0 1 -1 0 -3 -4 0 -3 -3 -2 0 -1 -4 -3 -3 4 1 -1 -50 +Z -1 0 0 1 -3 3 4 -2 0 -3 -3 1 -1 -3 -1 0 -1 -3 -2 -2 1 4 -1 -50 +X 0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2 0 0 -2 -1 -1 -1 -1 -1 -50 +* -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 -50 1 diff --git a/detectors/cds/test/test.db/models/splice.none.frq b/detectors/cds/test/test.db/models/splice.none.frq new file mode 100644 index 0000000..3a1626c --- /dev/null +++ b/detectors/cds/test/test.db/models/splice.none.frq @@ -0,0 +1,6 @@ +# 3'/5' splice null model +# A C G T +25 25 25 25 +splice +25 25 25 25 +# end of 3'/5' splice null model diff --git a/detectors/cds/test/test.db/models/splice3.default.frq b/detectors/cds/test/test.db/models/splice3.default.frq new file mode 100644 index 0000000..4ba2d4c --- /dev/null +++ b/detectors/cds/test/test.db/models/splice3.default.frq @@ -0,0 +1,13 @@ +# 3' splice model : default +# A C G T +19 18 27 36 +36 5 34 25 +20 7 51 23 +29 13 14 44 +splice +5 2 78 15 +3 7 15 75 +4 1 83 12 +5 51 13 31 +5 7 79 9 +53 10 27 11 diff --git a/detectors/cds/test/test.db/models/splice3.ndha.frq b/detectors/cds/test/test.db/models/splice3.ndha.frq new file mode 100644 index 0000000..3584fe3 --- /dev/null +++ b/detectors/cds/test/test.db/models/splice3.ndha.frq @@ -0,0 +1,13 @@ +# 3' splice model : ndha +# A C G T +1 43 1 56 +0 57 0 42 +41 1 2 56 +57 42 0 1 +splice +1 55 42 2 +0 1 57 42 +1 1 43 56 +2 11 56 31 +1 29 42 28 +41 1 57 1 diff --git a/detectors/cds/test/test.db/models/splice3.psba.frq b/detectors/cds/test/test.db/models/splice3.psba.frq new file mode 100644 index 0000000..21a6d8a --- /dev/null +++ b/detectors/cds/test/test.db/models/splice3.psba.frq @@ -0,0 +1,13 @@ +# 3' splice model : psba +# A C G T +26 14 40 21 +13 44 35 9 +41 3 33 23 +1 13 5 81 +splice +37 5 27 31 +62 5 9 24 +56 13 23 8 +32 28 6 33 +35 21 17 28 +53 12 10 26 diff --git a/detectors/cds/test/test.db/models/splice5.default.frq b/detectors/cds/test/test.db/models/splice5.default.frq new file mode 100644 index 0000000..b5cb067 --- /dev/null +++ b/detectors/cds/test/test.db/models/splice5.default.frq @@ -0,0 +1,13 @@ +# 5' splice model : default +# A C G T +15 42 3 40 +15 46 6 33 +13 32 2 53 +45 17 21 16 +70 13 6 11 +21 39 8 32 +splice +37 27 9 26 +31 35 17 17 +29 23 26 22 +30 25 28 17 diff --git a/detectors/cds/test/test.db/models/splice5.ndha.frq b/detectors/cds/test/test.db/models/splice5.ndha.frq new file mode 100644 index 0000000..fdad60d --- /dev/null +++ b/detectors/cds/test/test.db/models/splice5.ndha.frq @@ -0,0 +1,13 @@ +# 5' splice model : ndha +# A C G T +0 54 2 44 +43 1 1 56 +57 1 7 35 +8 1 39 52 +56 2 40 2 +55 1 0 44 +splice +1 0 2 97 +40 1 1 58 +55 0 1 44 +1 41 1 58 diff --git a/detectors/cds/test/test.db/models/splice5.psba.frq b/detectors/cds/test/test.db/models/splice5.psba.frq new file mode 100644 index 0000000..7785836 --- /dev/null +++ b/detectors/cds/test/test.db/models/splice5.psba.frq @@ -0,0 +1,13 @@ +# 5' splice model : psba +# A C G T +38 15 9 37 +40 5 13 42 +41 15 6 37 +32 9 15 44 +22 8 10 60 +0 9 83 8 +splice +33 15 27 24 +31 6 26 37 +17 28 6 49 +13 15 23 49 diff --git a/detectors/cds/test/test.db/models/start.default.frq b/detectors/cds/test/test.db/models/start.default.frq new file mode 100644 index 0000000..aa16582 --- /dev/null +++ b/detectors/cds/test/test.db/models/start.default.frq @@ -0,0 +1,8 @@ +# start model : default +atg 0.9692592 36165 +acg 0.01173885 438 +gtg 0.007504288 280 +ata 0.003886149 145 +atc 0.00337693 126 +att 0.002840909 106 +ttg 0.001393654 52 diff --git a/detectors/cds/test/test.db/models/start.ndhd.frq b/detectors/cds/test/test.db/models/start.ndhd.frq new file mode 100644 index 0000000..893232b --- /dev/null +++ b/detectors/cds/test/test.db/models/start.ndhd.frq @@ -0,0 +1,7 @@ +# start model : ndhd +acg 0.5066667 190 +atg 0.3493333 131 +atc 0.05066667 19 +ata 0.03466667 13 +acc 0.02933333 11 +gtg 0.02933333 11 diff --git a/detectors/cds/test/test.db/models/start.rps19.frq b/detectors/cds/test/test.db/models/start.rps19.frq new file mode 100644 index 0000000..59a3169 --- /dev/null +++ b/detectors/cds/test/test.db/models/start.rps19.frq @@ -0,0 +1,3 @@ +# start model : rps19 +gtg 0.6261023 355 +atg 0.3738977 212 diff --git a/detectors/cds/test/test.db/models/stop.default.frq b/detectors/cds/test/test.db/models/stop.default.frq new file mode 100644 index 0000000..f5f76e5 --- /dev/null +++ b/detectors/cds/test/test.db/models/stop.default.frq @@ -0,0 +1,4 @@ +# stop model : default (freq. ignored) +taa 0.5742367 21968 +tag 0.2351265 8995 +tga 0.1906368 7293 diff --git a/detectors/cds/test/test.ref b/detectors/cds/test/test.ref index 4101ab6..ba758bd 100644 --- a/detectors/cds/test/test.ref +++ b/detectors/cds/test/test.ref @@ -8,6 +8,7 @@ FT /gene="ccsA" FT /locus_tag="" FT /product="cytochrome c biogenesis protein" FT /inference="similar to DNA sequence:AC_000188:LyesCp084" +FT /inference="detect pass:pass1:core" FT /translation="MIFSTLEHILTHISFSIVSIVITIHLITFLVDEIVKLYDSSEKGI FT IVTFFCITGLLVTRWVSSGHFPLSDLYESLIFLSWSFSLIHIIPYFKKNVLILSKITGP FT SAILTQGFATSGILTEIHQSGILVPALQSEWLIMHVSMMILGYAALLCGSLLSVALLVI @@ -24,6 +25,7 @@ FT /gene="ndhA_1" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 1" FT /inference="similar to DNA sequence:AC_000188:LyesCp085" +FT /inference="detect pass:pass1:core" FT /translation="LSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERL FT PFDLPEAEEELVAGYQTEYSGIKFGLFYIASYLNLLVSSLFVTVLYLGGWNLSIPYIFV FT PDIFGINKGGKVFGTLIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPI @@ -38,6 +40,7 @@ FT /gene="ndhA_2" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 1" FT /inference="similar to DNA sequence:AC_000188:LyesCp085" +FT /inference="detect pass:pass1:core" FT /translation="MIIDTTEIETINSFSKLESLKEVYGIIWMLVPIVTLVLGITIGVL FT VIVWLEREISAGIQQRIGPEYAGPLGILQALADGTKLLLKENLIPSTGDTRLFSIGPSI FT AVISIFLSYSVIPFGDHLVLADLSIGVFFWIAISSIAPVGLLMSGYGSNNKYSFLGGLR @@ -52,6 +55,7 @@ FT /gene="ndhB" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 2" FT /inference="similar to DNA sequence:AC_000188:LyesCp066" +FT /inference="detect pass:pass1:core" FT /translation="MIWHVQNENFILDSTRIFMKAFHLLLFDGSLIFPECILIFGLILL FT LMIDSTSDQKDIPWLYFISSTSLVMSITALLFRWREEPMISFSGNFQTNNFNEIFQFLI FT LLCSTLCIPLSVEYIECTEMAITEFLLFVLTATLGGMFLCGANDLITIFVAPECFSLCS @@ -79,6 +83,7 @@ FT /gene="ndhD" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 4" FT /inference="similar to DNA sequence:AC_000188:LyesCp081" +FT /inference="detect pass:pass1:core" FT /translation="MNYFPWLTIIVVFPIFAGSLIFFLPHKGNRVIRWYTICICILELL FT LTTYAFCYHFQSDDPLIQLVEDYKWIDFFDFHWRLGIDGLSIGPILLTGFITTLATLAA FT WPVTRDSRLFHFLMLAMYSGQIGLFSSRDLLLFFIMWELELIPVYLLLAMWGGKKRLYS @@ -98,6 +103,7 @@ FT /gene="ndhE" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 4L" FT /inference="similar to DNA sequence:AC_000188:LyesCp080" +FT /inference="detect pass:pass1:core" FT /translation="MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINF FT VTFSDFFDNRQLKGDIFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN" FT gene complement(11509..13722) @@ -110,6 +116,7 @@ FT /gene="ndhF" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 5" FT /inference="similar to DNA sequence:AC_000188:LyesCp073" +FT /inference="detect pass:pass1:core" FT /translation="MEQTYEYAWIIPFIPLPVPMLIGAGLILFPTATKRFRRMWAFQSV FT LLLSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVG FT IMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIG @@ -133,6 +140,7 @@ FT /gene="ndhG" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 6" FT /inference="similar to DNA sequence:AC_000188:LyesCp077" +FT /inference="detect pass:pass1:core" FT /translation="MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVC FT TSLFYILSNAYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVC FT ISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIIL @@ -147,6 +155,7 @@ FT /gene="ndhH" FT /locus_tag="" FT /product="NADH dehydrogenase subunit 7" FT /inference="similar to DNA sequence:AC_000188:LyesCp078" +FT /inference="detect pass:pass1:core" FT /translation="MTAPTTRKDLMIVNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILG FT YLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITINGPEQLGNIQVPKRASYIRVI FT MLELSRIASHLLWLGPFMADIGAQTPFFYIFRERELIYDLFEAATGMRMMHNYFRIGGV @@ -164,6 +173,7 @@ FT /gene="ndhI" FT /locus_tag="" FT /product="NADH dehydrogenase subunit I" FT /inference="similar to DNA sequence:AC_000188:LyesCp076" +FT /inference="detect pass:pass1:core" FT /translation="MLPMITEFINYGQQTIRAARYIGQGFMITLSHANRLPVTIQYPYE FT KLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWKLETDIRKKRLLNYSIDFGIC FT IFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALGRLPMSVIDDYTIRTISNLPQ @@ -178,6 +188,7 @@ FT /gene="psaC" FT /locus_tag="" FT /product="photosystem I subunit VII" FT /inference="similar to DNA sequence:AC_000188:LyesCp065" +FT /inference="detect pass:pass1:core" FT /translation="MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRT FT EDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY" FT gene 53817..55307 @@ -190,6 +201,7 @@ FT /gene="rpl2" FT /locus_tag="" FT /product="ribosomal protein L2" FT /inference="similar to DNA sequence:AC_000188:LyesCp030" +FT /inference="detect pass:pass1:core" FT /translation="MAIHLYKTSTPSTRNGTVDSQVKSNPRNNLIYGQRRCGKGRNARG FT IITARHRGGGHKRLYRKIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILH FT PRGAIIGDTIVSGTEVPIKMGNALPSTDMPLGTAIHNIEITLGKGGQLARAAGAVAKLI @@ -213,6 +225,7 @@ FT /gene="rpl23" FT /locus_tag="" FT /product="ribosomal protein L23" FT /inference="similar to DNA sequence:AC_000188:LyesCp026" +FT /inference="detect pass:pass1:core" FT /translation="MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGV FT KVIAMNSHRLPGKSRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKKRT" FT gene 14505..14672 @@ -225,6 +238,7 @@ FT /gene="rpl32" FT /locus_tag="" FT /product="ribosomal protein L32" FT /inference="similar to DNA sequence:AC_000188:LyesCp036" +FT /inference="detect pass:pass1:core" FT /translation="MAVPKKRTSTSKKRIRKNIWKRKGYWVALKAFSLAKSLSTGNSKS FT FFVRQTKINK" FT gene complement(24633..24896) @@ -237,6 +251,7 @@ FT /gene="rps15" FT /locus_tag="" FT /product="ribosomal protein S15" FT /inference="similar to DNA sequence:AC_000188:LyesCp029" +FT /inference="detect pass:pass1:core" FT /translation="MVKNSVISVISQEEKKGSVEFQVFNFTNKIRRLTSHLELHKKDYL FT SQRGLKKILGKRQRLLAYLAKKNRVRYKELINRLDIRETKTR" FT gene 42157..42624 @@ -249,6 +264,7 @@ FT /gene="rps7" FT /locus_tag="" FT /product="ribosomal protein S7" FT /inference="similar to DNA sequence:AC_000188:LyesCp008" +FT /inference="detect pass:pass1:core" FT /translation="MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR FT AVKKIQQKTETNPLSVLRQAIRGVTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWL FT LAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR" @@ -262,6 +278,7 @@ FT /gene="ycf1" FT /locus_tag="" FT /product="hypothetical chloroplast RF1" FT /inference="similar to DNA sequence:AC_000188:LyesCp019" +FT /inference="detect pass:pass1:core" FT /translation="MIFQSFLLGNLVSLCMKIINSVVVVGLYYGFLTTFSIGPSYLFLL FT RALVMEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYLLFHFFW FT NNHKHFFDYGSTTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYLFRCNNK @@ -305,6 +322,7 @@ FT /gene="ycf2" FT /locus_tag="" FT /product="Ycf2" FT /inference="similar to DNA sequence:AC_000188:LyesCp004" +FT /inference="detect pass:pass1:core" FT /translation="MRGHQFKSWIFELREILREIKNSHHFLDSWTQFNSVGSFIHIFFH FT QERFLKLFDPRIWSILLSRNSQGSPSNRYFTIKGVILFVVAVLIYRINNRNMVERKNLY FT LIGLLPIPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVL diff --git a/scripts/csh_init.sh b/scripts/csh_init.sh index a19a362..93433eb 100644 --- a/scripts/csh_init.sh +++ b/scripts/csh_init.sh @@ -178,4 +178,4 @@ end # notification for debug # -------------------------------------- -Debug "---> $0" +Debug "---> $0 $argv"