#!/bin/bash # # Annotate the RPS12 gene of a plastide genome # #======================================================================================== # # The RPS12 gene is one of the CDS coding for a riboosomal protein # Depending on the species, the gene is constituted of oone to three exons. # The exon one is not located close to the others and a trans-splicing is needed # to reconstruct the spliced mRNA. The exons 2 and eventuually 3 can be located in the # inverted repeats (IRs) and therfore they can exist in two copies. This can lead to two # ways to annotate RPS12 # # # go_rps12.sh # # - : The fasta file containing the normalized genome to annotate # # Results are printed to the standart output # #======================================================================================== # -- CAUTION -- Works as long than the script # is not called through a symlink THIS_DIR="$(dirname ${BASH_SOURCE[0]})" source "${THIS_DIR}/../../../scripts/bash_init.sh" if [[ ! "$1" =~ ^/ ]]; then QUERY="${CALL_DIR}/$1" else QUERY="$1" fi if (( $# > 1 )) ; then TEMP=$2 else TEMP="" fi DBROOT="$CDS_DATA_DIR/chlorodb/RPS12" RPS12DB="${DBROOT}/RPS12_DB.clean.fst" DELTA=50 SEQLEN=$(seqlength "${QUERY}") SEQUENCE=$(readfirstfastaseq "${QUERY}") pushTmpDir ORG.RPS12 # localize the gene on the chloroplast genome using blast loginfo "Locating RPS12 gene by similarity..." blastx \ -query ${QUERY} \ -db ${RPS12DB} \ -query_gencode 11 \ -outfmt 7 \ | $AwkCmd ' # Blast HSPs are filtered to keep only # at maximum the 20 first ones having an # e-value below 1e-20 BEGIN {BEST_EVAL = 1e-40; OUT = 0} /^#/ {next} ($2 == PREV_CDS) { HSPs = HSPs "\n" $0;} (OUT < 20) && ($2 != PREV_CDS) && (BEST_EVAL < (1e-20 + 0.0)) { if (PREV_CDS) print HSPs; HSPs = $0; BEST_EVAL = 1; PREV_CDS = $2; OUT++ } {PREV_CDS = $2;} (BEST_EVAL > ($11 + 0.0)) {BEST_EVAL = ($11 + 0.0)} ' > "rps12_locate.hsps" # # Extracting protein ids from selected blast HSPs # $AwkCmd '{print $2}' "rps12_locate.hsps" \ | sort \ | uniq > "dbsel.txt" # # Extract corresponding protein sequences # from the RPS12 database. # mkdir -p RPS12 $AwkCmd -v FILE="dbsel.txt" \ -f $LIB_DIR/subdb.awk ${RPS12DB} \ > "RPS12/rps12.fasta" cat "rps12_locate.hsps" \ | $AwkCmd '# Normalizes the writing of the forward and reverse strand matches ($7 <= $8) {print $7,$8,$9,$10,"F"} ($7 > $8) {print $8,$7,$9,$10,"R"}' \ | sort -n \ | uniq \ | $AwkCmd 'function overlap(x1,y1,x2,y2) { return (((x1+0 <= x2+0) && ((y1+1) >= x2+0)) || ((x2+0 <= x1+0) && ((y2+1) >= x1+0))) } function min(a,b) {return (a <= b) ? a:b } function max(a,b) {return (a >= b) ? a:b } (NR==1) {i=0 frg[i]=$0 } (x1 && y1) { if (overlap(x1,y1,$1,$2)) { $1 = min(x1,$1) $2 = max(y1,$2) if (overlap(v1,w1,$3,$4)) { $3 = min(v1,$3) $4 = max(w1,$4) } } else i++ } (x1 && y1) { frg[i] = $0 } { x1 = $1 y1 = $2 v1 = $3 w1 = $4 } END { for (j = 0; j <= i; j++) { print frg[j] } } ' \ | sort -nk 3 \ | $AwkCmd '($3 != old3 || $4 != old4) { i++ old3=$3 old4=$4 } {print $0,i} ' \ | sort -nk 6 \ | $AwkCmd 'function min(a,b) {return (a <= b) ? a:b } (old6 == 1) { print old oldprint = 1 } ((old6 == 2 && $6==2) || full == 1) { print old full = 0 } (((old6 == 2 && $6==3) || (old6 == 3 && $6==2)) && full != 1) { $1 = old1 $6 = min(old6,$6) full = 1 } END {print old} { old = $0 old1 = $1 old6= $6 }' \ | $AwkCmd -v delta="$DELTA" \ -v seqlen="$SEQLEN" \ -v chloro="$SEQUENCE" \ 'function min(a,b) {return (a <= b) ? a:b } function max(a,b) {return (a >= b) ? a:b } function rev(s) { x = "" for (i=length(s);i!=0;i--) x=x substr(s,i,1) return x } function swapchar(s,a,b) { gsub(a,"@",s) gsub(b,a,s) gsub(/@/,b,s) return s } function revcomp(s) { s = swapchar(s,"A","T") s = swapchar(s,"C","G") s = swapchar(s,"M","K") s = swapchar(s,"R","Y") s = swapchar(s,"W","S") s = swapchar(s,"B","V") s = swapchar(s,"D","H") s = swapchar(s,"a","t") s = swapchar(s,"c","g") s = swapchar(s,"m","k") s = swapchar(s,"r","y") s = swapchar(s,"w","s") s = swapchar(s,"b","v") s = swapchar(s,"d","h") return rev(s) } { from = max(1,$1 - delta) to = min($2 + delta,seqlen) sequence = substr(chloro,from,to-from+1) if ($5 == "R") sequence = revcomp(sequence) nparts[$6]+=1 n = nparts[$6] parts[$6][n][1] = from parts[$6][n][2] = to parts[$6][n][3] = $3 parts[$6][n][4] = $4 parts[$6][n][5] = $5 parts[$6][n][6] = $6 parts[$6][n][7] = sequence } END { l = length(parts) if (l==1) { n = nparts[1] for (i =1; i <= n; i++) { print ">RPS12_" i,"parts=1; limit=" length(parts[1][i][7]) + 1 \ "; from1=" parts[1][i][1] \ "; to1=" parts[1][i][2] "; strand1=" parts[1][i][5] \ ";" > "rps12_fragments_" i ".fasta" print parts[1][i][7] \ > "rps12_fragments_" i ".fasta" } } if (l==2) { n1 = nparts[1] n2 = nparts[2] for (i =1; i <= n1; i++) for (j =1; j <= n2; j++) { k = (i-1)*n2+j print ">RPS12_" k,"parts=2", \ "limit=" (length(parts[1][i][7]) + 10 + 1) \ "; from1=" parts[1][i][1] "; to1=" parts[1][i][2] "; strand1=" parts[1][i][5] \ "; from2=" parts[2][j][1] "; to2=" parts[2][j][2] "; strand2=" parts[2][j][5] \ ";" > "rps12_fragments_" k ".fasta" print parts[1][i][7] "nnnnnnnnnn" parts[2][j][7] \ > "rps12_fragments_" k ".fasta" } } } ' nrps12=$(ls -1 rps12_fragments_*.fasta | wc -l) if (( nrps12 > 1 )) ; then message="$nrps12 versions" else message="$nrps12 version" fi loginfo "$message of the gene rps12 detected." # # Run exonarate on every fragment of chloroplast # # It should be one or two fragments # export PASS1_SPEEDUP=0 cp $DBROOT/Annot.lst RPS12 nbseq = 0 for fasta in rps12_fragments_*.fasta ; do tcsh -f ${PROG_DIR}/do_exonerate.csh \ $fasta \ "RPS12/rps12.fasta" \ $DBROOT/../models $(pwd) ((nbseq=nbseq+1)) done # # Rewrite the coordinates of the genes on the extracted # fragment to the chloroplaste genome coordinates # n=0 for f in *.res ; do ((n=n+1)) mv $f $f.ori if [[ -z "$TEMP" ]] ; then dest="/dev/stdout" else dest="$TEMP/$f" fi header=$(head -1 ${f/.rps12.res/.fasta}) L2=$(sed -E 's/^.*limit=([0-9]+);.*$/\1/' <<< $header) S1=$(sed -E 's/^.*strand1=(R|F);.*$/\1/' <<< $header) S2=$(sed -E 's/^.*strand2=(R|F);.*$/\1/' <<< $header) F1=$(sed -E 's/^.*from1=([0-9]+);.*$/\1/' <<< $header) F2=$(sed -E 's/^.*from2=([0-9]+);.*$/\1/' <<< $header) T1=$(sed -E 's/^.*to1=([0-9]+);.*$/\1/' <<< $header) T2=$(sed -E 's/^.*to2=([0-9]+);.*$/\1/' <<< $header) cat $f.ori \ | $AwkCmd -v S1="$S1" -v F1="$F1" -v T1="$T1" \ -v S2="$S2" -v F2="$F2" -v T2="$T2" -v L2="$L2" \ ' function convert1p(p) { if (p+0 < L2) { I = 1 if (S1=="F") { S = 1 B = F1 } else { S = -1 B = T1 } } else { I = L2 if (S2=="F") { S = 1 B = F2 } else { S = -1 B = T2 } } return S*(p - I) + B } function convert(p1,p2) { p1 = convert1p(p1) p2 = convert1p(p2) if (p1 < p2) res = p1 ".." p2 else res = "complement(" p2 ".." p1 ")" return res } /[0-9]+\.\.[0-9]+/ { s = $0 r = $0 while (length(s) > 0) { match(s,/[0-9]+\.\.[0-9]+/) range = substr(s,RSTART,RLENGTH) s = substr(s,RSTART+RLENGTH+1) match(range,/^[0-9]+/) from = substr(range,RSTART,RLENGTH) match(range,/[0-9]+$/) to = substr(range,RSTART,RLENGTH) sub(range,convert(from,to),r) } $0=r } {print $0} ' \ | $AwkCmd ' # # Normalize join(complement(A),complement(B),complement(C)) locations # into complement(join(C,B,A)) # /join\((complement\([0-9]+\.\.[0-9]+\),)+complement\([0-9]+\.\.[0-9]+\)\)/ \ { sub(/join\(complement/,"complement(join",$0) gsub(/\),complement\(/,",",$0) match($0,/[0-9]+\.\.[0-9]+(,[0-9]+\.\.[0-9]+)*/) positions=substr($0,RSTART,RLENGTH) n = split(positions,exons,",") for (i=1; i<=n; i++) { if (i > 1) rexons = exons[i] "," rexons else rexons = exons[i] } sub(positions,rexons,$0) } { print $0} ' \ | $AwkCmd ' /^FT [^ ]/ && (length($0) > 80) { n = split($0,parts,",") j = 1 for (i = 1; i <= n; i++) { if (length(line) + length(parts[i]) > 78) { print line "," line = "FT " j = i } if (i > j) line = line "," line = line parts[i] } $0 = line } {print $0} ' | \ $AwkCmd -v n=$n -v nbseq=$nbseq ' /^FT +\/gene="rps12"/ && (nbseq > 1) { sub(/rps12/,"rps12_" n,$0) } { print $0 } ' > $dest done popTmpDir exit 0 # NC_010654.fst # location=complement(join(77925..77967,78465..78700,52867..52980)); # location=join(complement(52867..52980),109583..109818,110316..110358); # 52837 52980 1 48 R 1 # 77928 77981 113 130 R 3 # 78458 78712 39 132 R 2 # 109571 109825 39 132 F 2 # 110302 110355 113 130 F 3 # /translation="MPTNPQLIRDARQQKKKKRGSRGLQRCPQRRGVCARVYNINPKK # --> MPTNPQLIRDARQQKKKKRGSRGLQRCPQRRGVCARVSNINPKK # ==> MPTNPQLIRDARQQKKKKRGSRGLQRCPQRRGVCARVSNINPKK # PNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTL # --> PNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTL # ==> PNSALRKVARVRLTSGFEITAYIPGIGHNLQEHSVVLVRGGRVKDLPGVKYRIVRGTL # DAVAVKNRQQGRSSAIWSQKAEKKVIHF" # --> DAVAVKNRQQGRSSAIWSQKAEKKVIHF # ==> DAVAVKNRQQGRSSAIWSQKAEKKVIHF # ADL.norm.fasta # 69300 69425 1 42 R 1 # 97365 97670 36 137 R 2 # 130601 130906 36 137 F 2 # NC_008822 # location=90942..91313; # 90942 91310 1 123 F 1 # location=complement(join(77925..77967,78465..78700,52867..52980)); # >RPS12_1 parts=2 limit=255; from1=52787; to1=53030; strand1=R; from2=77878; to2=78762; strand2=R; # join(51..159,312..553,1051..1092) # location=join(complement(52867..52980),109583..109818,110316..110358); # >RPS12_2 parts=2 limit=254; from1=52787; to1=53030; strand1=R; from2=109521; to2=110405; strand2=F; # join\((complement\([0-9]+\.\.[0-9]+\),)+complement\([0-9]+\.\.[0-9]+\)\) # cat NC_010654.annot.embl | awk -v tag="agser" 'BEGIN {n=0} /\locus_tag/ {n++; sub(/""/, sprintf("\"%s%04d\"",tag,n),$0)} {print $0}' | less # BRR.chloro_1 NC_018117_rps12_2 96.08 102 4 0 99022 98717 36 137 9e-57 195 # BRR.chloro_1 NC_018117_rps12_2 96.08 102 4 0 141187 141492 36 137 9e-57 195 # BRR.chloro_1 NC_018117_rps12_2 94.87 39 2 0 70611 70495 1 39 2e-16 78.6